Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats^[1].

IC50: GLP-1 receptor^[1]

Exendin (5-39) (intracerebroventricular injection; 0.3 μg; once daily; 1-week) increases GLT-1 protein levels in the hippocampus of male Wistar rats. Additionally, hippocampal slices are prepared from Ex-treated or vehicle rats,Exendin (5-39) decreases fEPSP decay time and increases the input-output relation and decreased the paired-pulse ratio in the dentate gyrus (DG). Furthermore, Ex inhibits long-term depression but not long-term potentiation in the DG^[1].

3806.30

C₁₆₉H₂₆₂N₄₄O₅₄S

196109-27-0

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.