β-CGRP, human (Human β-CGRP) is one ofcalcitoninpeptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), withIC₅₀s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells^[1].

IC50: 1 nM (CRLR/RAMP1, cell assay), 300 nM (CRLR/RAMP2, cell assay)^[1]

β-CGRP, human is one of calcitonin peptides, acts via complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC₅₀s of 1 nM in both SK-N-MC and Swiss 3T3 cells express CRLR and RAMP1, and 130 nM and 300 nM in NG108-15 and HEK293T cells expressing CRLR and RAMP2^[1]. CGRP is a potent vasodilator and also shows pro- and -anti-inflammatory activity^[2].

3793.41

C₁₆₂H₂₆₇N₅₁O₄₈S₃

101462-82-2

Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)

ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.